PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G129900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family GRF
Protein Properties Length: 245aa    MW: 27370 Da    PI: 8.7182
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G129900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.33.7e-25148192145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRCsr+v++ +k+CErH+hrgr+rsrk +e+
  Aqcoe2G129900.2.p 148 DPEPGRCRRTDGKKWRCSREVVPAHKYCERHVHRGRNRSRKLVET 192
                        79***************************************9986 PP

2QLQ53.57.1e-1976111237
                QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         F+ aQ+q+L+ Q+l++Ky++a++PvP+eLl +i+k
  Aqcoe2G129900.2.p  76 LFSLAQWQELELQALIFKYMLAGAPVPAELLHPIKK 111
                        59********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.1E-1075111IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.51576111IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.3E-1477109IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.248148192IPR014977WRC domain
PfamPF088793.4E-21149191IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDFDLKQWKN QQQHESEHDQ QPSAKIPRLL LEPPHHPSDV ASALPLFVPE PNSRMSNSLS  60
AFSDSTTTRF SGMGCLFSLA QWQELELQAL IFKYMLAGAP VPAELLHPIK KSLLTTPSAA  120
CYLYPFQQYQ HYQPTMLQSG YWGRNAVDPE PGRCRRTDGK KWRCSREVVP AHKYCERHVH  180
RGRNRSRKLV ETATPTAIEG DQKTPNPPAA LPITNASGTP FALSGSPPLA NLIQLNQRDD  240
SSNT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243928.15e-97PREDICTED: growth-regulating factor 3
SwissprotQ8L8A78e-62GRF4_ARATH; Growth-regulating factor 4
TrEMBLF6HKI66e-89F6HKI6_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g03760.t012e-88(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.13e-53growth-regulating factor 4